PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01001096G0260
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family GRF
Protein Properties Length: 371aa    MW: 40368.1 Da    PI: 6.6764
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01001096G0260genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC42.89.1e-147297126
              WRC  1 daepgrCrRtDGKkWRCsrrvlegkk 26
                     d+epgrCrRtDGKkWRCsr++++++k
  PH01001096G0260 72 DPEPGRCRRTDGKKWRCSRDAVADQK 97
                     79*********************997 PP

2QLQ56.11.1e-19642137
              QLQ  1 saFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37
                     ++FT++Q+ +L++Q+l+yKyLaan PvP+ Ll +i++
  PH01001096G0260  6 GPFTPSQWIELEHQALIYKYLAANSPVPHGLLIPIRR 42
                     59*********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009511.8E-10642IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088805.1E-14741IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166622.602742IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166713.96272120IPR014977WRC domain
PfamPF088792.5E-107397IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 371 aa     Download sequence    Send to blast
MTRVRGPFTP SQWIELEHQA LIYKYLAANS PVPHGLLIPI RRSLASPYTP AYFGTSTLGW  60
GSFQLGYSGS ADPEPGRCRR TDGKKWRCSR DAVADQKEPV NKQNESEQMQ DSDSLSMLTS  120
MNMRNTGSLF PFSKQHNPFE VTSSRPDFGL VSSDSLMSSP HSSLENVNLL GSQSMNEHQS  180
AVSLQHYVDW PRTPAQGALA WPDTEEMQAQ RTQLSISAAM ASSDLSSAST SPIHEKLMLS  240
PLKLRHEYSP IGLSFAANKD EVCQGEANWT PMFRDSSMGG PLGEVLTKNS TMEARNCLSA  300
SLNLLTDGWD SSPGLQSSPV GVLQKTTFGP VSSSTGSSPR LENHSVYDGI SNLRGDLGSI  360
VVNHPSTRRV *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015628630.11e-146PREDICTED: growth-regulating factor 6
SwissprotQ6AWY31e-147GRF6_ORYSJ; Growth-regulating factor 6
TrEMBLJ3LSG80.0J3LSG8_ORYBR; Uncharacterized protein
STRINGOB03G39940.10.0(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP42903568
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37740.12e-35growth-regulating factor 2